Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSDC1 Rabbit Polyclonal Antibody (HRP)

BSDC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP4-811H24.7, DKFZp686B09139, FLJ10276

UniProt

Q9NW68

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BSDC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060515

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDA polyclonal antibody
BS7348-01 50 µL

CDA polyclonal antibody

Sign In for Pricing
View Details
CDA polyclonal antibody
BS7348-02 100 µL

CDA polyclonal antibody

Sign In for Pricing
View Details
Bovine F-box/WD repeat-containing protein 7 (FBXW7) ELISA Kit
OM624155 96 Strip Well

Bovine F-box/WD repeat-containing protein 7 (FBXW7) ELISA Kit

Sign In for Pricing
View Details
GFRα-4 Polyclonal Antibody
RA25301-01 50 µL

GFRα-4 Polyclonal Antibody

Sign In for Pricing
View Details
GFRα-4 Polyclonal Antibody
RA25301-02 100 µL

GFRα-4 Polyclonal Antibody

Sign In for Pricing
View Details
ERN1 (Endoplasmic Reticulum to Nucleus Signaling 1, FLJ30999, IRE1, IRE1P, MGC163277, MGC163279) (MaxLight 490)
245829-ML490 100 µL

ERN1 (Endoplasmic Reticulum to Nucleus Signaling 1, FLJ30999, IRE1, IRE1P, MGC163277, MGC163279) (MaxLight 490)

Sign In for Pricing
View Details