Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD2 Rabbit Polyclonal Antibody (HRP)

ANKRD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARPP

UniProt

Q3B778

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAE47432

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diazoxide choline-d3
CS-O-59079 1 Each

Diazoxide choline-d3

Sign In for Pricing
View Details
KDM1A Antibody
orb2311533-01 20 µg

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
orb2311533-02 100 µg

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
orb2311533-03 100 ug (without BSA and Azide)

KDM1A Antibody

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Mouse mAb Antibody
orb397338 100 µL

Placental alkaline phosphatase (PLAP) Mouse mAb Antibody

Sign In for Pricing
View Details
STK16 (Serine/threonine-protein Kinase 16, Tyrosine-protein Kinase STK16, Myristoylated and Palmitoylated Serine/threonine-protein Kinase, MPSK, MPSK1, Protein Kinase PKL12, hPSK, TGF-beta-stimulated Factor 1, TSF1, TSF-1)
133967 100 µg

STK16 (Serine/threonine-protein Kinase 16, Tyrosine-protein Kinase STK16, Myristoylated and Palmitoylated Serine/threonine-protein Kinase, MPSK, MPSK1, Protein Kinase PKL12, hPSK, TGF-beta-stimulated Factor 1, TSF1, TSF-1)

Sign In for Pricing
View Details