Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Rabbit Polyclonal Antibody (Biotin)

GPR87 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GPR95, FKSG78, KPG_002

UniProt

Q9BY21

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GPR87

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_076404

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R, R) -Hydroxy Des (boric Acid) Bortezomib
166111 2.5 mg

(R, R) -Hydroxy Des (boric Acid) Bortezomib

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)
MBS1110756-01 0.02 mg (Baculovirus)

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)
MBS1110756-02 0.1 mg (Baculovirus)

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)
MBS1110756-03 1 mg (Baculovirus)

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)
MBS1110756-04 5x 1 mg (Baculovirus)

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)

Sign In for Pricing
View Details
CD301 Mouse Monoclonal Antibody
TD-31669 100 µL

CD301 Mouse Monoclonal Antibody

Sign In for Pricing
View Details