Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Rabbit Polyclonal Antibody (HRP)

GPR87 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPR95, FKSG78, KPG_002

UniProt

Q9BY21

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GPR87

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_076404

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Ribonuclease H (RNASEH) ELISA Kit
abx356611 96 Well

Chicken Ribonuclease H (RNASEH) ELISA Kit

Sign In for Pricing
View Details
GAB2 CRISPR Knock Out 293T Cell Line (Human)
21138141 1x 10^6 Cells / 1.0 mL

GAB2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
MAdCAM1 (Mucosal Addressin Cell Adhesion Molecule 1, Addressin)
369567 200 µL

MAdCAM1 (Mucosal Addressin Cell Adhesion Molecule 1, Addressin)

Sign In for Pricing
View Details
IRF-2 (G-10) Alexa Fluor® 680
sc-374327 AF680 200 µg/mL

IRF-2 (G-10) Alexa Fluor® 680

Sign In for Pricing
View Details
2-Chloro-1-[2- (thiophen-3-yl) pyrrolidin-1-yl]ethan-1-one
EXB11921-01 50 mg

2-Chloro-1-[2- (thiophen-3-yl) pyrrolidin-1-yl]ethan-1-one

Sign In for Pricing
View Details
2-Chloro-1-[2- (thiophen-3-yl) pyrrolidin-1-yl]ethan-1-one
EXB11921-02 0.5 g

2-Chloro-1-[2- (thiophen-3-yl) pyrrolidin-1-yl]ethan-1-one

Sign In for Pricing
View Details