Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Rabbit Polyclonal Antibody (HRP)

GPR87 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPR95, FKSG78, KPG_002

UniProt

Q9BY21

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR87

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076404

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ASCIZ Antibody [Janelia Fluor 646]
NBP1-79016JF646 0.1 mL

Rabbit Polyclonal ASCIZ Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
DDIT3 Polyclonal Antibody, Cy7 Conjugated
bs-20669R-Cy7 100 µL

DDIT3 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Cysteine Dioxygenase Type 1 Antibody [DyLight 594]
NBP2-82081DL594 0.1 mL

Rabbit Polyclonal Cysteine Dioxygenase Type 1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Adcy7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3988207 1.0 µg DNA

Adcy7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Ribonuclease 7 (Rnase7) Elisa Kit
EKC41883 96 Tests

Human Ribonuclease 7 (Rnase7) Elisa Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD300a/LMIR1 Antibody (MEM-260) [mFluor Violet 450 SE]
NB110-58726MFV450 0.1 mL

Mouse Monoclonal CD300a/LMIR1 Antibody (MEM-260) [mFluor Violet 450 SE]

Sign In for Pricing
View Details