Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Rabbit Polyclonal Antibody (HRP)

GPR87 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPR95, FKSG78, KPG_002

UniProt

Q9BY21

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR87

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076404

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTGF Antibody (C-term)
orb1928900 400 µL

CTGF Antibody (C-term)

Sign In for Pricing
View Details
CCDC157 Lentiviral Activation Particles (m)
sc-432096-LAC 200 µL

CCDC157 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
STAT1 Rabbit Monoclonal Antibody [KD Validated]
E46F61713 40 µL

STAT1 Rabbit Monoclonal Antibody [KD Validated]

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF647 conjugate, 0.1mg/mL
BNC470700-100 1x 100 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APP Antibody
E10-30709T 100 µL

APP Antibody

Sign In for Pricing
View Details
IL-1α CRISPR Activation Plasmid (h2)
sc-418057-ACT-2 20 µg

IL-1α CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details