Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMO3 Rabbit Polyclonal Antibody (HRP)

ELMO3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CED12, CED-12, ELMO-3

UniProt

Q96BJ8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELMO3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLALKPTSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD102 Antibody
OADB00007-200UG 200 µg

CD102 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Protein CysZ (cysZ)
MBS1257224 Inquire

Recombinant Escherichia coli O7:K1 Protein CysZ (cysZ)

Sign In for Pricing
View Details
ARHGAP44 Rabbit pAb
E45R27325N 50 ul

ARHGAP44 Rabbit pAb

Sign In for Pricing
View Details
KCNK18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1123408 1.0 µg DNA

KCNK18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Guinea Pig CUB and sushi domain containing protein 2 (CSMD2) ELISA kit
GTR10423766 96 Well

Guinea Pig CUB and sushi domain containing protein 2 (CSMD2) ELISA kit

Sign In for Pricing
View Details
Mypop Mouse siRNA Oligo Duplex (Locus ID 232934)
SR413184 1 Kit

Mypop Mouse siRNA Oligo Duplex (Locus ID 232934)

Sign In for Pricing
View Details