Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ14213 Rabbit Polyclonal Antibody (HRP)

FLJ14213 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PROTOR2

UniProt

Q6MZQ0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ14213

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079117

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PARK7/DJ1 Antibody Picoband® (monoclonal, 4B10), HRP Conjugate
M00757-4-HRP 100 µg/Vial

Anti-PARK7/DJ1 Antibody Picoband® (monoclonal, 4B10), HRP Conjugate

Sign In for Pricing
View Details
ZC3H4 (NM_015168) Human Untagged Clone
SC316034 10 µg

ZC3H4 (NM_015168) Human Untagged Clone

Sign In for Pricing
View Details
Chicken CA19-9 ELISA Kit
ECKC0678 96 Tests

Chicken CA19-9 ELISA Kit

Sign In for Pricing
View Details
Rat Atg10 Pre-designed siRNA Set B
SI201080B 1 Each

Rat Atg10 Pre-designed siRNA Set B

Sign In for Pricing
View Details
LRRCC1 Human siRNA Oligo Duplex (Locus ID 85444)
SR313865 1 Kit

LRRCC1 Human siRNA Oligo Duplex (Locus ID 85444)

Sign In for Pricing
View Details
Porcine epidermal growth factor receptor, EGFR ELISA KIT
E0145Po-01 48 Well

Porcine epidermal growth factor receptor, EGFR ELISA KIT

Sign In for Pricing
View Details