Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf134 Rabbit Polyclonal Antibody (Biotin)

C6orf134 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TAT, MEC17, C6orf134, Nbla00487, alpha-TAT, alpha-TAT1

UniProt

Q9H8X5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFC Polyclonal Antibody, RBITC Conjugated
bs-5775R-RBITC 100 µL

PDGFC Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ephrin-A3 CRISPR/Cas9 KO Plasmid (h)
sc-402771 20 µg

ephrin-A3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Mas1 Rabbit Polyclonal Antibody
TA328708 50 µL

Mas1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GPR155 Antibody
NBP1-50626SS 0.025 mL

Rabbit Polyclonal GPR155 Antibody

Sign In for Pricing
View Details
RKIP Blocking Peptide
MBS822905-01 1 mg

RKIP Blocking Peptide

Sign In for Pricing
View Details
RKIP Blocking Peptide
MBS822905-02 5 mg

RKIP Blocking Peptide

Sign In for Pricing
View Details