Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf134 Rabbit Polyclonal Antibody (FITC)

C6orf134 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TAT, MEC17, C6orf134, Nbla00487, alpha-TAT, alpha-TAT1

UniProt

Q9H8X5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal STAT6 Antibody (177C322.1) [DyLight 755]
NBP2-25241IR 0.1 mL

Mouse Monoclonal STAT6 Antibody (177C322.1) [DyLight 755]

Sign In for Pricing
View Details
Human LINC02868 qPCR Primer Pair
QH75445S 200 Tests

Human LINC02868 qPCR Primer Pair

Sign In for Pricing
View Details
CCL7 Antibody
orb619433 100 µL

CCL7 Antibody

Sign In for Pricing
View Details
Bovine Apolipoprotein E,APOE ELISA KIT
JOT-EKA0057BO 96 wells

Bovine Apolipoprotein E,APOE ELISA KIT

Sign In for Pricing
View Details
Mitochondrial Respiratory Chain Complex V (F0F1-ATPase/ATP Synthase) Tissue Assay Kit
abx295098 96 Tests

Mitochondrial Respiratory Chain Complex V (F0F1-ATPase/ATP Synthase) Tissue Assay Kit

Sign In for Pricing
View Details
EIF3S4 (EIF3G) (NM_003755) Human Over-expression Lysate
E45H19148-2 20 µg

EIF3S4 (EIF3G) (NM_003755) Human Over-expression Lysate

Sign In for Pricing
View Details