Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf134 Rabbit Polyclonal Antibody (HRP)

C6orf134 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAT, MEC17, C6orf134, Nbla00487, alpha-TAT, alpha-TAT1

UniProt

Q9H8X5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-432-5p miRNA Antagomir
abx885492-01 10 nmol

Human hsa-miR-432-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-432-5p miRNA Antagomir
abx885492-02 20 nmol

Human hsa-miR-432-5p miRNA Antagomir

Sign In for Pricing
View Details
C15orf40 Knockout Hela Polyclonal Cells
ARG23571 1 Million

C15orf40 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
UPP1 ReadyGo IHC Kit
SIHCZ-0260-01 50 Tests (No Control Slide)

UPP1 ReadyGo IHC Kit

Sign In for Pricing
View Details
UPP1 ReadyGo IHC Kit
SIHCZ-0260-02 50 Tests (With Control Slide)

UPP1 ReadyGo IHC Kit

Sign In for Pricing
View Details
HSD17B7 ORF Vector (Human) (pORF)
23941012 1.0 µg DNA

HSD17B7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details