Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf134 Rabbit Polyclonal Antibody (HRP)

C6orf134 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAT, MEC17, C6orf134, Nbla00487, alpha-TAT, alpha-TAT1

UniProt

Q5SQI0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf134

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ANG2 (C-6His)
C01P-10ug 10 µg

Recombinant Human ANG2 (C-6His)

Sign In for Pricing
View Details
Mouse Anti-Human CD29 mAb (PE/Cy5) [TS2/16.2.1]
E2781441 100 Tests

Mouse Anti-Human CD29 mAb (PE/Cy5) [TS2/16.2.1]

Sign In for Pricing
View Details
Lentiviral human FZD3 shRNA (UAS) - Lentiviral human FZD3 shRNA (UAS, GFP) (100)
GTR15332904 1 Vial

Lentiviral human FZD3 shRNA (UAS) - Lentiviral human FZD3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Protein delta homolog 2, DLK2 ELISA KIT
ELI-08284h 96 Tests

Human Protein delta homolog 2, DLK2 ELISA KIT

Sign In for Pricing
View Details
SCLIP Double Nickase Plasmid (h2)
sc-406430-NIC-2 20 µg

SCLIP Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
COL2A1 Rabbit Polyclonal Antibody
E53P06796 100 µL

COL2A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details