Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf134 Rabbit Polyclonal Antibody (HRP)

C6orf134 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAT, MEC17, C6orf134, Nbla00487, alpha-TAT, alpha-TAT1

UniProt

Q5SQI0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf134

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homer-2a/b CRISPR/Cas9 KO Plasmid (h)
sc-402910 20 µg

Homer-2a/b CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Purified anti-human CD56 (NCAM)
GT11900 100 µg

Purified anti-human CD56 (NCAM)

Sign In for Pricing
View Details
Krtap16-5 Protein Vector (Mouse) (pPM-C-HA)
26138024 500 ng

Krtap16-5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Dlst sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7129605 3x 1.0 µg

Dlst sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human RAR Related Orphan Receptor Gamma (RORg) ELISA Kit
orb778208-01 48 Tests

Human RAR Related Orphan Receptor Gamma (RORg) ELISA Kit

Sign In for Pricing
View Details
Human RAR Related Orphan Receptor Gamma (RORg) ELISA Kit
orb778208-02 96 Tests

Human RAR Related Orphan Receptor Gamma (RORg) ELISA Kit

Sign In for Pricing
View Details