Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP2447 Rabbit Polyclonal Antibody (FITC)

PP2447 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LP6054, PP2447

UniProt

Q9H4I3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PP2447

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXD4 Lentiviral Activation Particles (h2)
sc-410784-LAC-2 200 µL

FOXD4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Rabbit Polyclonal Anti-CADM2 Antibody (Internal)
TA341261 50 µg

Rabbit Polyclonal Anti-CADM2 Antibody (Internal)

Sign In for Pricing
View Details
FSD1 (GLFND, MIR1, Fibronectin Type III and SPRY Domain-containing Protein 1, MID1-related Protein 1, Microtubule-associated Protein GLFND, VLP27, MGC3213) (MaxLight 550)
MBS6378951-01 0.1 mL

FSD1 (GLFND, MIR1, Fibronectin Type III and SPRY Domain-containing Protein 1, MID1-related Protein 1, Microtubule-associated Protein GLFND, VLP27, MGC3213) (MaxLight 550)

Sign In for Pricing
View Details
FSD1 (GLFND, MIR1, Fibronectin Type III and SPRY Domain-containing Protein 1, MID1-related Protein 1, Microtubule-associated Protein GLFND, VLP27, MGC3213) (MaxLight 550)
MBS6378951-02 5x 0.1 mL

FSD1 (GLFND, MIR1, Fibronectin Type III and SPRY Domain-containing Protein 1, MID1-related Protein 1, Microtubule-associated Protein GLFND, VLP27, MGC3213) (MaxLight 550)

Sign In for Pricing
View Details
SERPINA3 discontinued
394273 200 µL

SERPINA3 discontinued

Sign In for Pricing
View Details
Triethanolamine
50292003-500g 500 g

Triethanolamine

Sign In for Pricing
View Details