Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP2447 Rabbit Polyclonal Antibody (HRP)

PP2447 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LP6054, PP2447

UniProt

Q9H4I3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PP2447

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated
PKSH033999-01 20 µg

Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated
PKSH033999-02 100 µg

Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
Clathrin, Heavy Chain (CHC/1432), CF640R conjugate, 0.1mg/mL
BNC401432-100 1x 100 µL

Clathrin, Heavy Chain (CHC/1432), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF405S conjugate, 0.1mg/mL
BNC040845-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF740 conjugate, 0.1mg/mL
BNC742375-100 1x 100 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Mouse CD8b.2 Antibody[53-5.8]
AN00564E-01 50 Tests

APC Anti-Mouse CD8b.2 Antibody[53-5.8]

Sign In for Pricing
View Details