Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP2447 Rabbit Polyclonal Antibody (HRP)

PP2447 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LP6054, PP2447

UniProt

Q9H4I3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PP2447

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylenediamine Dihydrochloride
TRC-E918353-1G 1 g

Ethylenediamine Dihydrochloride

Sign In for Pricing
View Details
POU5F1B Rabbit Polyclonal Antibody
TA380184 100 µL

POU5F1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD1E (NM_030893) Human Over-expression Lysate
LY403088 100 µg

CD1E (NM_030893) Human Over-expression Lysate

Sign In for Pricing
View Details
Human QIL1 (C19orf70) activation kit by CRISPRa
GA114905 1 Kit

Human QIL1 (C19orf70) activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833T-01 25 µg

Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833T-02 100 µg

Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details