Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcaf11 Rabbit Polyclonal Antibody (FITC)

Dcaf11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GLO, Wdr2, GLO14, Wdr23, C76035, D14Ucl, Dacf11, D14Ucla1, 0710008A13Rik

UniProt

Q9EQQ2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WDRRTMREDDPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Vascular Endothelial Growth Factor D (VEGFD) ELISA Kit
RD-VEGFD-b-48Tests 48 Tests

Bovine Vascular Endothelial Growth Factor D (VEGFD) ELISA Kit

Sign In for Pricing
View Details
EPHB3/Eph receptor B3 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62350R-PerCP-Cy5.5 100 µL

EPHB3/Eph receptor B3 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
CYP27A1 Antibody - N-terminal region (ARP73811_P050)
ARP73811_P050 100 µL

CYP27A1 Antibody - N-terminal region (ARP73811_P050)

Sign In for Pricing
View Details
Olfr725 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4274706 1.0 µg DNA

Olfr725 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
COL1A2 Polyclonal Antibody
MBS2530057-01 0.02 mL

COL1A2 Polyclonal Antibody

Sign In for Pricing
View Details
COL1A2 Polyclonal Antibody
MBS2530057-02 0.06 mL

COL1A2 Polyclonal Antibody

Sign In for Pricing
View Details