Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC19A3 Rabbit Polyclonal Antibody (HRP)

SLC19A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BBGD, THMD2, THTR2, thTr-2

UniProt

Q9BZV2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC19A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079519

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fpr-rs6 Double Nickase Plasmid (m)
sc-435855-NIC 20 µg

Fpr-rs6 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
CCL11 sgRNA CRISPR Lentivector set (Human)
K0389501 3x 1.0 µg

CCL11 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
(Mouse) Msi1 Antibody (Center)
orb1926806-01 50 µL

(Mouse) Msi1 Antibody (Center)

Sign In for Pricing
View Details
(Mouse) Msi1 Antibody (Center)
orb1926806-02 100 µL

(Mouse) Msi1 Antibody (Center)

Sign In for Pricing
View Details
Pig Protein canopy homolog 3, CNPY3 ELISA Kit
MBS9332234-01 48 Well

Pig Protein canopy homolog 3, CNPY3 ELISA Kit

Sign In for Pricing
View Details
Pig Protein canopy homolog 3, CNPY3 ELISA Kit
MBS9332234-02 96 Well

Pig Protein canopy homolog 3, CNPY3 ELISA Kit

Sign In for Pricing
View Details