Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALPG Rabbit Polyclonal Antibody (HRP)

ALPG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GCAP, ALPPL, ALPPL2

UniProt

P10696

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ALPPL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112603

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF385C Lentiviral Activation Particles (m2)
sc-435518-LAC-2 200 µL

ZNF385C Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Anti Human PITX3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8424489-01 0.12 mL

Rabbit Anti Human PITX3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human PITX3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8424489-02 0.2 mL

Rabbit Anti Human PITX3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human PITX3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8424489-03 5x 0.2 mL

Rabbit Anti Human PITX3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Ethanol, 50 % v/v, 100 ML
M-CSS-330 4x 25 mL

Ethanol, 50 % v/v, 100 ML

Sign In for Pricing
View Details
PCMV-Eif4e3-3xFLAG-Neo Plasmid
PVT79354 2 µg

PCMV-Eif4e3-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details