Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM129A Rabbit Polyclonal Antibody (Biotin)

FAM129A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GIG39, NIBAN, C1orf24, FAM129A

UniProt

Q9BZQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM129A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443198

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse TCR γ/δ Antibody[UC7-13D5]
E-AB-F1124A-01 25 µg

Purified Anti-Mouse TCR γ/δ Antibody[UC7-13D5]

Sign In for Pricing
View Details
Purified Anti-Mouse TCR γ/δ Antibody[UC7-13D5]
E-AB-F1124A-02 100 µg

Purified Anti-Mouse TCR γ/δ Antibody[UC7-13D5]

Sign In for Pricing
View Details
Phenylglycine Ethyl Ester Hydrochloride
TRC-P327230-50MG 50 mg

Phenylglycine Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
C19orf46 (SYNE4) (NM_001039876) Human Over-expression Lysate
LY421842 100 µg

C19orf46 (SYNE4) (NM_001039876) Human Over-expression Lysate

Sign In for Pricing
View Details
Coelenterazine IP
#10116 1x 50 µg

Coelenterazine IP

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF405S conjugate, 0.1mg/mL
BNC042923-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details