Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSAD2 Rabbit Polyclonal Antibody (Biotin)

RSAD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cig5, vig1, cig33

UniProt

Q8WXG1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RSAD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAL1 Rabbit pAb, IRDye 800CW conjugated
orb2879348 100 µL

KAL1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
MLLT10 (Protein AF-10, Myeloid/Lymphoid or Mixed-Lineage Leukemia; Translocated to, 10)
485897 100 µL

MLLT10 (Protein AF-10, Myeloid/Lymphoid or Mixed-Lineage Leukemia; Translocated to, 10)

Sign In for Pricing
View Details
CD8 beta Protein, Human, Recombinant, Biotinylated
TMPY-04925-01 5 µg

CD8 beta Protein, Human, Recombinant, Biotinylated

Sign In for Pricing
View Details
CD8 beta Protein, Human, Recombinant, Biotinylated
TMPY-04925-02 10 µg

CD8 beta Protein, Human, Recombinant, Biotinylated

Sign In for Pricing
View Details
CD8 beta Protein, Human, Recombinant, Biotinylated
TMPY-04925-03 20 µg

CD8 beta Protein, Human, Recombinant, Biotinylated

Sign In for Pricing
View Details
CD8 beta Protein, Human, Recombinant, Biotinylated
TMPY-04925-04 50 µg

CD8 beta Protein, Human, Recombinant, Biotinylated

Sign In for Pricing
View Details