Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIPF6 Rabbit Polyclonal Antibody (FITC)

YIPF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FinGER6

UniProt

Q96EC8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human YIPF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_776195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Sample Volume Mouse Advanced Glycosylation End Product-Specific Receptor (AGER) ELISA Kit
abx570606-01 96 Tests

Low Sample Volume Mouse Advanced Glycosylation End Product-Specific Receptor (AGER) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Mouse Advanced Glycosylation End Product-Specific Receptor (AGER) ELISA Kit
abx570606-02 5x 96 Tests

Low Sample Volume Mouse Advanced Glycosylation End Product-Specific Receptor (AGER) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Mouse Advanced Glycosylation End Product-Specific Receptor (AGER) ELISA Kit
abx570606-03 10x 96 Tests

Low Sample Volume Mouse Advanced Glycosylation End Product-Specific Receptor (AGER) ELISA Kit

Sign In for Pricing
View Details
Th (NM_012740) Rat Tagged Lenti ORF Clone
RR206330L4 10 µg

Th (NM_012740) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66; Rabbit Polyclonal (Concentrate)
RA0695-C1 1 mL

Carcinoembryonic Antigen (CEA) / CD66; Rabbit Polyclonal (Concentrate)

Sign In for Pricing
View Details
Guinea Pig Coiled coil domain containing protein 85C (CCDC85C) ELISA kit
GTR10453417 96 Well

Guinea Pig Coiled coil domain containing protein 85C (CCDC85C) ELISA kit

Sign In for Pricing
View Details