Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES2 Rabbit Polyclonal Antibody (HRP)

CES2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ICE, CE-2, PCE-2, CES2A1

UniProt

O00748

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CES2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_932327

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK2 Rabbit Polyclonal Antibody (PE-Cy5)
orb945997 100 µL

CDK2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
GLUT 1 (Glucose Transporter 1, GLUT-1, GLUT, Glucose Transporter Type 1 Erythrocyte/brain, GLUTB, DYT17, DYT18, HepG2 Glucose Transporter, MGC141895, MGC141896, PED, Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 1, SLC2A1) (PE) discontinued
G3900-03H-PE 100 µL

GLUT 1 (Glucose Transporter 1, GLUT-1, GLUT, Glucose Transporter Type 1 Erythrocyte/brain, GLUTB, DYT17, DYT18, HepG2 Glucose Transporter, MGC141895, MGC141896, PED, Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 1, SLC2A1) (PE) discontinued

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)
MBS2148086-01 0.1 mL

APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)
MBS2148086-02 0.2 mL

APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)
MBS2148086-03 0.5 mL

APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)
MBS2148086-04 1 mL

APC-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)

Sign In for Pricing
View Details