Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC6 Rabbit Polyclonal Antibody (FITC)

SIGLEC6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CD327, CD33L, OBBP1, CD33L1, CD33L2, CDW327

UniProt

O43699

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIGLEC6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_942143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (TP53/2092R), CF740 conjugate, 0.1mg/mL
BNC742092-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/2092R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR561731 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
C1orf56 (NM_017860) Human Over-expression Lysate
LY402623 100 µg

C1orf56 (NM_017860) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: carotid
CS506125 5x 5 µm

Frozen Tissue Sections, Artery: carotid

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right upper lobe
CR562425 5 µg

Tissue Total RNA, Lung: right upper lobe

Sign In for Pricing
View Details
Chromogranin A (CHGA) Mouse Monoclonal Antibody [Clone ID: SPM339]
AM50102PU-S 100 µg

Chromogranin A (CHGA) Mouse Monoclonal Antibody [Clone ID: SPM339]

Sign In for Pricing
View Details