Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41 Rabbit Polyclonal Antibody (HRP)

EPB41 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HE, EL1, 4.1R

UniProt

Q4VB86

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EPB41

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_976218

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipid C24
HY-149156 5 mg

Lipid C24

Sign In for Pricing
View Details
Mouse single stranded DNA Antibody (ssDNA) ELISA Kit
MBS9313892-01 48 Well

Mouse single stranded DNA Antibody (ssDNA) ELISA Kit

Sign In for Pricing
View Details
Mouse single stranded DNA Antibody (ssDNA) ELISA Kit
MBS9313892-02 96 Well

Mouse single stranded DNA Antibody (ssDNA) ELISA Kit

Sign In for Pricing
View Details
Mouse single stranded DNA Antibody (ssDNA) ELISA Kit
MBS9313892-03 5x 96 Well

Mouse single stranded DNA Antibody (ssDNA) ELISA Kit

Sign In for Pricing
View Details
Mouse single stranded DNA Antibody (ssDNA) ELISA Kit
MBS9313892-04 10x 96 Well

Mouse single stranded DNA Antibody (ssDNA) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human RETN Protein
CRP2207-01 10 µg

Recombinant Human RETN Protein

Sign In for Pricing
View Details