Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFDN-DT Rabbit Polyclonal Antibody (FITC)

AFDN-DT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AFDN-AS1, C6orf124

UniProt

Q9Y6Z5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human MLLT4-AS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGTGSGRAVLGLDGRCSIQMGAAGSGRAVLGSVRTGGAGSKWAVLGSAGD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ligase Ligand-linker Conjugate 28
HY-162194 1 Each

E3 Ligase Ligand-linker Conjugate 28

Sign In for Pricing
View Details
(R) - (-) -2-Aminoheptane
sc-236548A 1 g

(R) - (-) -2-Aminoheptane

Sign In for Pricing
View Details
TMEM55B CRISPR/Cas9 KO Plasmid (m)
sc-432339 20 µg

TMEM55B CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
PIP5K2A, NT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI(5)P 4-kinase Type II alpha,
MBS6493043-01 0.1 mL

PIP5K2A, NT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI(5)P 4-kinase Type II alpha,

Sign In for Pricing
View Details
PIP5K2A, NT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI(5)P 4-kinase Type II alpha,
MBS6493043-02 5x 0.1 mL

PIP5K2A, NT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI(5)P 4-kinase Type II alpha,

Sign In for Pricing
View Details
CTSK Peptide - middle region
MBS3239939-01 0.1 mg

CTSK Peptide - middle region

Sign In for Pricing
View Details