Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRX3 Rabbit Polyclonal Antibody (Biotin)

IRX3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IRX-1, IRXB1

UniProt

P78415

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IRX3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_077312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-Glycoprotein (ABC20, ABCB1, ATP Binding Cassette, Subfamily B (MDR/TAP), Member 1, ATP-binding Cassette Subfamily B Member 1, CD243, CLCS, Colchicin Sensitivity, Doxorubicin Resistance, GP170, MDR1, MDR1_HUMAN, Multidrug Resistance 1, Multidrug Resistance Protein 1, P Glycoprotein 1, P Gp, P-glycoprotein 1, PGY1)
303505 100 µg

P-Glycoprotein (ABC20, ABCB1, ATP Binding Cassette, Subfamily B (MDR/TAP), Member 1, ATP-binding Cassette Subfamily B Member 1, CD243, CLCS, Colchicin Sensitivity, Doxorubicin Resistance, GP170, MDR1, MDR1_HUMAN, Multidrug Resistance 1, Multidrug Resistance Protein 1, P Glycoprotein 1, P Gp, P-glycoprotein 1, PGY1)

Sign In for Pricing
View Details
PELP1 Rabbit Polyclonal Antibody
orb632964-01 50 µg

PELP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PELP1 Rabbit Polyclonal Antibody
orb632964-02 100 µg

PELP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chlamydia trachomatis IgG Control Serum
C1372G 1 Each

Chlamydia trachomatis IgG Control Serum

Sign In for Pricing
View Details
GBA2 Knockout HEK293T Polyclonal Cells
ARG4510 1 Million

GBA2 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Rabies Virus proteins IgG antibody ELISA
EIA D1006-AB01-5 480 Well

Rabies Virus proteins IgG antibody ELISA

Sign In for Pricing
View Details