Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (HEK293, hFc)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (HEK293, hFc) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-hek-293-hfc.html

Purity

95.00

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 58-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Upadacitinib Impurity 99
RM-U220099-01 10 mg

Upadacitinib Impurity 99

Sign In for Pricing
View Details
Upadacitinib Impurity 99
RM-U220099-02 25 mg

Upadacitinib Impurity 99

Sign In for Pricing
View Details
Upadacitinib Impurity 99
RM-U220099-03 50 mg

Upadacitinib Impurity 99

Sign In for Pricing
View Details
Upadacitinib Impurity 99
RM-U220099-04 100 mg

Upadacitinib Impurity 99

Sign In for Pricing
View Details
Recombinant Human CPLX1 Protein, N-His
E55P0233 50 µg

Recombinant Human CPLX1 Protein, N-His

Sign In for Pricing
View Details
5,7-Diamino-8-hydroxy-carbostyril Dihydrochloride
162014 25 mg

5,7-Diamino-8-hydroxy-carbostyril Dihydrochloride

Sign In for Pricing
View Details