Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS8 Rabbit Polyclonal Antibody (Biotin)

RGS8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP11-317P15.2, MGC119067, MGC119068, MGC119069

UniProt

P57771

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RGS8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_203131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR7 (NM_004686) Human Over-expression Lysate
LS009108-100ug 100 µg

MTMR7 (NM_004686) Human Over-expression Lysate

Sign In for Pricing
View Details
PTEN Polyclonal Antibody, PerCP Conjugated
bs-0686R-PerCP-01 20 µL

PTEN Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
PTEN Polyclonal Antibody, PerCP Conjugated
bs-0686R-PerCP-02 100 µL

PTEN Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Lycopersicon esculentum (LEL/LEA) (Agarose) Microcolumn
518504 300ul

Lycopersicon esculentum (LEL/LEA) (Agarose) Microcolumn

Sign In for Pricing
View Details
Bovine Leukotriene B4 receptor 1, LTB4R ELISA Kit
MBS9304874-01 48 Well

Bovine Leukotriene B4 receptor 1, LTB4R ELISA Kit

Sign In for Pricing
View Details
Bovine Leukotriene B4 receptor 1, LTB4R ELISA Kit
MBS9304874-02 96 Well

Bovine Leukotriene B4 receptor 1, LTB4R ELISA Kit

Sign In for Pricing
View Details