Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS8 Rabbit Polyclonal Antibody (Biotin)

RGS8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP11-317P15.2, MGC119067, MGC119068, MGC119069

UniProt

P57771

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RGS8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_203131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit
MBS7247759-01 48 Well

Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit

Sign In for Pricing
View Details
Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit
MBS7247759-02 96 Well

Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit

Sign In for Pricing
View Details
Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit
MBS7247759-03 5x 96 Well

Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit

Sign In for Pricing
View Details
Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit
MBS7247759-04 10x 96 Well

Sheep Alpha-protein kinase 1 (ALPK1) ELISA Kit

Sign In for Pricing
View Details
FDX1 3'UTR Luciferase Stable Cell Line
TU007865 1.0 mL

FDX1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RN5S375 AAV Vector (Human) (CMV)
39957101 1 µg

RN5S375 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details