FGF-8f, Human
FGF-8f Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.
Product Specifications
Product Name Alternative
FGF-8f Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-8f-protein-human.html
Purity
95.0
Smiles
MQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Molecular Formula
2253 (Gene_ID) P55075-4 (Q23-R244) (Accession)
Molecular Weight
Approximately 25.5 kDa
References & Citations
[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2428-100 1x 100 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), 0.2mg/mL
Sign In for Pricing
View Details 
LY421926 100 µg
ARL4 (ARL4A) (NM_001037164) Human Over-expression Lysate
Sign In for Pricing
View Details 
PKSH034042-01 20 µg
Recombinant Human IL-5 (C-6His-Avi) Biotinylated
Sign In for Pricing
View Details PKSH034042-02 100 µg
Recombinant Human IL-5 (C-6His-Avi) Biotinylated
Sign In for Pricing
View Details 
![ERK2 Mouse Monoclonal Antibody [C3B12]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82be5/imageurl/em1901-55.webp)