Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-8f, Human

FGF-8f Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Product Specifications

Product Name Alternative

FGF-8f Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-8f-protein-human.html

Purity

95.0

Smiles

MQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Formula

2253 (Gene_ID) P55075-4 (Q23-R244) (Accession)

Molecular Weight

Approximately 25.5 kDa

References & Citations

[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ndufa2 activation kit by CRISPRa
GA202849 1 Kit

Mouse Ndufa2 activation kit by CRISPRa

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (rSOX2/1792), CF405S conjugate, 0.1mg/mL
BNC043810-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1792), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse BID Protein (His & GST Tag)
PKSM040720 100 µg

Recombinant Mouse BID Protein (His & GST Tag)

Sign In for Pricing
View Details
GAD65 (GAD2) (515-528) Goat Polyclonal Antibody
AP23035PU-N 50 µg

GAD65 (GAD2) (515-528) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS643617 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Polystyrene A CHO
HA12516006.25G 25 g

Polystyrene A CHO

Sign In for Pricing
View Details