Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-8f, Human

FGF-8f Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Product Specifications

Product Name Alternative

FGF-8f Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-8f-protein-human.html

Purity

95.0

Smiles

MQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Formula

2253 (Gene_ID) P55075-4 (Q23-R244) (Accession)

Molecular Weight

Approximately 25.5 kDa

References & Citations

[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arhgap32 Mouse Gene Knockout Kit (CRISPR)
KN501507 1 Kit

Arhgap32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fibronectin (FN1) Human qPCR Primer Pair (NM_212482)
HP234005 200 Reactions

Fibronectin (FN1) Human qPCR Primer Pair (NM_212482)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
(R)-Butyryl Carnitine Chloride
TRC-B802700-250MG 250 mg

(R)-Butyryl Carnitine Chloride

Sign In for Pricing
View Details