Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gja4 Rabbit Polyclonal Antibody (Biotin)

Gja4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cnx3, Cx37, Gja-, Cnx37, Cxnh1, Gja-4, AU020209, AW558810

UniProt

P35212

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RREERLRQKEGELRALPSKDLHVERALAAIEHQMAKISVAEDGRLRIRGA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_032146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Binding Protein Antibody
GWB-B4A7EE 1 mg

Fatty Acid Binding Protein Antibody

Sign In for Pricing
View Details
GPR82 (Probable G-protein Coupled Receptor 82)
170775 50 µg

GPR82 (Probable G-protein Coupled Receptor 82)

Sign In for Pricing
View Details
Human Bifunctional Purine Biosynthesis Protein PURH (ATIC) ELISA Kit
abx385922 96 Tests

Human Bifunctional Purine Biosynthesis Protein PURH (ATIC) ELISA Kit

Sign In for Pricing
View Details
Empagliflozin Impurity 32
RM-E131632-01 10 mg

Empagliflozin Impurity 32

Sign In for Pricing
View Details
Empagliflozin Impurity 32
RM-E131632-02 25 mg

Empagliflozin Impurity 32

Sign In for Pricing
View Details
Empagliflozin Impurity 32
RM-E131632-03 50 mg

Empagliflozin Impurity 32

Sign In for Pricing
View Details