Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gja4 Rabbit Polyclonal Antibody (Biotin)

Gja4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cnx3, Cx37, Gja-, Cnx37, Cxnh1, Gja-4, AU020209, AW558810

UniProt

P35212

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RREERLRQKEGELRALPSKDLHVERALAAIEHQMAKISVAEDGRLRIRGA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_032146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCCA2 (MOB2) (NM_053005) Human 3' UTR Clone
SC209408 10 µg

HCCA2 (MOB2) (NM_053005) Human 3' UTR Clone

Sign In for Pricing
View Details
BrightDiluent, red antibody diluent
orb1478689 1 Unit

BrightDiluent, red antibody diluent

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)
MBS1258727-01 0.02 mg (E-Coli)

Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)
MBS1258727-02 0.1 mg (E-Coli)

Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)
MBS1258727-03 0.02 mg (Yeast)

Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)
MBS1258727-04 0.1 mg (Yeast)

Recombinant Cronobacter sakazakii Translation initiation factor IF-1 (infA)

Sign In for Pricing
View Details