Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gja8 Rabbit Polyclonal Antibody (Biotin)

Gja8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Lo, Aey, dcm, Aey5, Cnx5, Cx50, Cxnl, Cnx50, Lop10

UniProt

P28236

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAM Polyclonal Antibody
MBS2574513-01 0.06 mL

MGAM Polyclonal Antibody

Sign In for Pricing
View Details
MGAM Polyclonal Antibody
MBS2574513-02 0.12 mL

MGAM Polyclonal Antibody

Sign In for Pricing
View Details
MGAM Polyclonal Antibody
MBS2574513-03 0.2 mL

MGAM Polyclonal Antibody

Sign In for Pricing
View Details
MGAM Polyclonal Antibody
MBS2574513-04 5x 0.2 mL

MGAM Polyclonal Antibody

Sign In for Pricing
View Details
FNDC3B, NT (HCV NS5A-binding Protein 37, Factor For Adipocyte Differentiation 104, Fibronectin Type III Domain-containing Protein 3B, FAD104, NS5ABP37, UNQ2421/PRO4979/PRO34274) (MaxLight 550) discontinued
F4216-20-ML550 100 µL

FNDC3B, NT (HCV NS5A-binding Protein 37, Factor For Adipocyte Differentiation 104, Fibronectin Type III Domain-containing Protein 3B, FAD104, NS5ABP37, UNQ2421/PRO4979/PRO34274) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-NQO1 Antibody (2T646)
TMAY-02207 100 µL

Anti-NQO1 Antibody (2T646)

Sign In for Pricing
View Details