Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cldn3 Rabbit Polyclonal Antibody (FITC)

Cldn3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cpet, mRVP1, Cpetr2, AI182374

UniProt

Q9Z0G9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034032

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (MaxLight 750)
MBS6241421-01 0.1 mL

ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (MaxLight 750)

Sign In for Pricing
View Details
ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (MaxLight 750)
MBS6241421-02 5x 0.1 mL

ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Anti Human LEP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8424158-01 0.12 mL

Rabbit Anti Human LEP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Rabbit Anti Human LEP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8424158-02 0.2 mL

Rabbit Anti Human LEP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Rabbit Anti Human LEP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8424158-03 5x 0.2 mL

Rabbit Anti Human LEP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
RPRD1A Polyclonal Antibody
MBS2574006-01 0.06 mL

RPRD1A Polyclonal Antibody

Sign In for Pricing
View Details