Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gja10 Rabbit Polyclonal Antibody (HRP)

Gja10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cx59, Cxnn, cx57, Cx-57, connex

UniProt

Q9WUS4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVWDDEQS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034419

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNFRSF18/GITR ELISA Kit PicoKine®
EK0768 96 Well With Removable Strips

Human TNFRSF18/GITR ELISA Kit PicoKine®

Sign In for Pricing
View Details
S Antigen (SAG) Antibody
abx237580 100 µg

S Antigen (SAG) Antibody

Sign In for Pricing
View Details
TRNAS24 Protein Vector (Human) (pPB-C-His)
PV140194 500 ng

TRNAS24 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human FOLR2, His tagged
FOLR2-2244H 50 µg

Recombinant Human FOLR2, His tagged

Sign In for Pricing
View Details
Slc9a5 (NM_001081332) Mouse Untagged Clone
MC222497 10 µg

Slc9a5 (NM_001081332) Mouse Untagged Clone

Sign In for Pricing
View Details
Influenza A H5N8 (A/duck/Zhejiang/6D18/2013) HA Protein (HA1 Subunit), His Tag
VAG277 50 µg

Influenza A H5N8 (A/duck/Zhejiang/6D18/2013) HA Protein (HA1 Subunit), His Tag

Sign In for Pricing
View Details