Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa6 Rabbit Polyclonal Antibody (FITC)

Anxa6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A, An, Cab, Cam, Anx6, Cabm, Camb, AnxVI, AW107198

UniProt

P14824

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Anxa6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHOX_ALCSP Goat Polyclonal Antibody
TA396685S 25 µL

CHOX_ALCSP Goat Polyclonal Antibody

Sign In for Pricing
View Details
RGR (NM_001012720) Human Over-expression Lysate
LC422820 20 µg

RGR (NM_001012720) Human Over-expression Lysate

Sign In for Pricing
View Details
alpha Synuclein (SNCA) Rabbit Polyclonal Antibody
AP08065PU-S 50 µL

alpha Synuclein (SNCA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF568 conjugate, 0.1mg/mL
BNC682049-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/2049R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TissueScan, Lymphoma cDNA Array II
LYRT102 2 Panels

TissueScan, Lymphoma cDNA Array II

Sign In for Pricing
View Details
ASF1B Mouse Monoclonal Antibody [Clone ID: AT1D4]
AM50339PU-S 50 µL

ASF1B Mouse Monoclonal Antibody [Clone ID: AT1D4]

Sign In for Pricing
View Details