Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa6 Rabbit Polyclonal Antibody (FITC)

Anxa6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A, An, Cab, Cam, Anx6, Cabm, Camb, AnxVI, AW107198

UniProt

P14824

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Anxa6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA Tag (16.43), 0.2mg/mL
BNUB2543-100 1x 100 µL

HA Tag (16.43), 0.2mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF488A conjugate, 0.1mg/mL
BNC882616-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EDIL3 Human Gene Knockout Kit (CRISPR)
KN205282LP 1 Kit

EDIL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SINHCAF activation kit by CRISPRa
GA111795 1 Kit

Human SINHCAF activation kit by CRISPRa

Sign In for Pricing
View Details
Calpain 1 Antibody
KC-19937-01 50 μL

Calpain 1 Antibody

Sign In for Pricing
View Details
Calpain 1 Antibody
KC-19937-02 100 µL

Calpain 1 Antibody

Sign In for Pricing
View Details