Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rgs1 Rabbit Polyclonal Antibody (Biotin)

Rgs1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BL3, BL34

UniProt

Q9JL25

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056626

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF740 conjugate, 0.1mg/mL
BNC741747-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (CD45RC) Rat Monoclonal Antibody [Clone ID: IBL-8]
AM31873FC-N 100 µg

CD45 / LCA (CD45RC) Rat Monoclonal Antibody [Clone ID: IBL-8]

Sign In for Pricing
View Details
CF®498 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20995-50uL 1x 50 µL

CF®498 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details
Ticabesone Propionate
TRC-T437600-10MG 10 mg

Ticabesone Propionate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS802931 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
APC Anti-Human CD56/NCAM Antibody[B-A19]
E-AB-F1305E-01 20 Tests

APC Anti-Human CD56/NCAM Antibody[B-A19]

Sign In for Pricing
View Details