Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rgs1 Rabbit Polyclonal Antibody (HRP)

Rgs1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BL3, BL34

UniProt

Q9JL25

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Rgs1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GMKSAKSKDILSAEEVMQWSQSLEKLLANQTGQNVFGRFLKSEFSEENIE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056626

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOMM6 AAV Vector (Mouse) (CMV)
47297104 1 µg

TOMM6 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
DR5/TNFRSF10B Rabbit Polyclonal Antibody (APC)
orb2616117 100 µg

DR5/TNFRSF10B Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Filamin Standard Grade From Chicken Gizzard
GWB-955E5F 0.25 mg

Filamin Standard Grade From Chicken Gizzard

Sign In for Pricing
View Details
Human IgG Antibody
N0343-01 50 µL

Human IgG Antibody

Sign In for Pricing
View Details
Human IgG Antibody
N0343-02 100 µL

Human IgG Antibody

Sign In for Pricing
View Details
Human IgG Antibody
N0343-03 200 µL

Human IgG Antibody

Sign In for Pricing
View Details