Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rgs1 Rabbit Polyclonal Antibody (HRP)

Rgs1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BL3, BL34

UniProt

Q9JL25

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Rgs1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GMKSAKSKDILSAEEVMQWSQSLEKLLANQTGQNVFGRFLKSEFSEENIE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056626

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctns (NM_001191647) Rat Untagged Clone
RN216494 10 µg

Ctns (NM_001191647) Rat Untagged Clone

Sign In for Pricing
View Details
Zfp382 (NM_144749) Rat Tagged Lenti ORF Clone
RR209876L4 10 µg

Zfp382 (NM_144749) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse ZFAND5 shRNA Plasmid
abx973453-01 150 µg

Mouse ZFAND5 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ZFAND5 shRNA Plasmid
abx973453-02 300 µg

Mouse ZFAND5 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant FMDV Capsid protein VP1 Protein, N-His
YVV16501 100 μg

Recombinant FMDV Capsid protein VP1 Protein, N-His

Sign In for Pricing
View Details
Rat FCGBP ELISA Kit (Colorimetric)
NBP3-00381 1 Kit

Rat FCGBP ELISA Kit (Colorimetric)

Sign In for Pricing
View Details