Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa13 Rabbit Polyclonal Antibody (Biotin)

Anxa13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AV055219, 1810034H17Rik

UniProt

Q99JG3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Carbohydrate Sulfotransferase 3/CHST3 Antibody (1D3)
H00009469-M02 0.1 mg

Mouse Monoclonal Carbohydrate Sulfotransferase 3/CHST3 Antibody (1D3)

Sign In for Pricing
View Details
CYP2C19 Rabbit Polyclonal Antibody (BF350)
orb2459867 100 µL

CYP2C19 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
EIF4G3 (Eukaryotic Translation Initiation Factor 4 gamma 3, eIF-4-gamma 3, eIF-4G 3, eIF4G 3, eIF-4-gamma II, eIF4GII)
MBS6008320-01 0.1 mg

EIF4G3 (Eukaryotic Translation Initiation Factor 4 gamma 3, eIF-4-gamma 3, eIF-4G 3, eIF4G 3, eIF-4-gamma II, eIF4GII)

Sign In for Pricing
View Details
EIF4G3 (Eukaryotic Translation Initiation Factor 4 gamma 3, eIF-4-gamma 3, eIF-4G 3, eIF4G 3, eIF-4-gamma II, eIF4GII)
MBS6008320-02 5x 0.1 mg

EIF4G3 (Eukaryotic Translation Initiation Factor 4 gamma 3, eIF-4-gamma 3, eIF-4G 3, eIF4G 3, eIF-4-gamma II, eIF4GII)

Sign In for Pricing
View Details
SWAP-70 CRISPR/Cas9 KO Plasmid (m)
sc-423229 20 µg

SWAP-70 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
TRIM49L1-set siRNA/shRNA/RNAi Lentivector (Human)
47796091 4x 500 ng

TRIM49L1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details