Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa13 Rabbit Polyclonal Antibody (FITC)

Anxa13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AV055219, 1810034H17Rik

UniProt

Q99JG3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elite Dry Bath Incubator (single block unit) ; without block
EL-01-110/220 1 Unit

Elite Dry Bath Incubator (single block unit) ; without block

Sign In for Pricing
View Details
TRIM22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G2]
TA505278AM 100 µL

TRIM22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G2]

Sign In for Pricing
View Details
Human IL-1 alpha / IL-1F1 Protein, premium grade
ILA-H5214-1mg 1 mg

Human IL-1 alpha / IL-1F1 Protein, premium grade

Sign In for Pricing
View Details
Recombinant Human Ribonuclease 3/RNASE3 Protein (His Tag)
PKSH033002-01 10 µg

Recombinant Human Ribonuclease 3/RNASE3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Ribonuclease 3/RNASE3 Protein (His Tag)
PKSH033002-02 50 µg

Recombinant Human Ribonuclease 3/RNASE3 Protein (His Tag)

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-8404
BCAJ-8404 1 Unit

CO2 Incubator Air Jacketed BCAJ-8404

Sign In for Pricing
View Details