Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa13 Rabbit Polyclonal Antibody (HRP)

Anxa13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AV055219, 1810034H17Rik

UniProt

Q99JG3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F2 CRISPRa sgRNA lentivector (set of three targets)(Human)
18828121 3x 1.0µg DNA

E2F2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit
MBS742001-01 48 Well

Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit
MBS742001-02 96 Well

Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit
MBS742001-03 5x 96 Well

Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit
MBS742001-04 10x 96 Well

Bovine Soluble Triggering Receptor Expresses on Myeloid Cells-1 ELISA Kit

Sign In for Pricing
View Details
Human SLAM/CD150 (Signaling Lymphocytic Activation Molecule) ELISA Kit
EH0112 96 Tests

Human SLAM/CD150 (Signaling Lymphocytic Activation Molecule) ELISA Kit

Sign In for Pricing
View Details