Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx1 Rabbit Polyclonal Antibody (Biotin)

Alx1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Car, Cart1, AI314867, C130005I02

UniProt

Q8C8B0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human SCUBE1 Over-expressing Stable Cell Line
ABC-X2740 1 Vial

Xpress™ Human SCUBE1 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Mipp1 Antibody
orb806284 2 mg

Mipp1 Antibody

Sign In for Pricing
View Details
Rage (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, Ager)
MBS6508197-01 0.5 mg

Rage (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, Ager)

Sign In for Pricing
View Details
Rage (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, Ager)
MBS6508197-02 5x 0.5 mg

Rage (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, Ager)

Sign In for Pricing
View Details
HLA G Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61409R-BF594-01 20 µL

HLA G Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
HLA G Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61409R-BF594-02 100 µL

HLA G Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details