Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx1 Rabbit Polyclonal Antibody (HRP)

Alx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Car, Cart1, AI314867, C130005I02

UniProt

Q8C8B0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA6 Antibody
E19-8971-1 50 µg - 50 µL

IFNA6 Antibody

Sign In for Pricing
View Details
Protein S Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9512R-BF405-TR 20 µL

Protein S Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
MEOX2 (GAX, MOX2) discontinued
511474 100 µg

MEOX2 (GAX, MOX2) discontinued

Sign In for Pricing
View Details
KLF17 shRNA (m) Lentiviral Particles
sc-105600-V 200 µL

KLF17 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Erwinia carotovora subsp. atroseptica Triosephosphate isomerase (tpiA)
MBS1426379-01 0.02 mg (E-Coli)

Recombinant Erwinia carotovora subsp. atroseptica Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Erwinia carotovora subsp. atroseptica Triosephosphate isomerase (tpiA)
MBS1426379-02 0.02 mg (Yeast)

Recombinant Erwinia carotovora subsp. atroseptica Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details