Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parp8 Rabbit Polyclonal Antibody (Biotin)

Parp8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARTD16, D13Ertd275, D13Ertd275e, 2810430O08Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Parp8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074478

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[(S)-2,2'-Bis(diphenylphosphino)-1,1'-binaphthyl]dichlororuthenium
TRC-B430400-250MG 250 mg

[(S)-2,2'-Bis(diphenylphosphino)-1,1'-binaphthyl]dichlororuthenium

Sign In for Pricing
View Details
Isopentyl Pentyl Phthalate
TRC-I821930-50MG 50 mg

Isopentyl Pentyl Phthalate

Sign In for Pricing
View Details
Vertical Autoclave BAVT-302-B
BAVT-302-B 1 Unit

Vertical Autoclave BAVT-302-B

Sign In for Pricing
View Details
Benzylamine Hydrochloride
TRC-B411095-500MG 500 mg

Benzylamine Hydrochloride

Sign In for Pricing
View Details
Mouse Serping1 activation kit by CRISPRa
GA200458 1 Kit

Mouse Serping1 activation kit by CRISPRa

Sign In for Pricing
View Details
PRAS40 Antibody
KC-1985-01 50 μL

PRAS40 Antibody

Sign In for Pricing
View Details