Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parp8 Rabbit Polyclonal Antibody (HRP)

Parp8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD16, D13Ertd275, D13Ertd275e, 2810430O08Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Parp8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074478

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MINOS1 Antibody
NBP2-31802 0.1 mL

Rabbit Polyclonal MINOS1 Antibody

Sign In for Pricing
View Details
Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)
MBS8116006-01 0.3 mg

Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)
MBS8116006-02 5x 0.3 mg

Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
IRAK3 polyclonal antibody
BS7148-01 50 µL

IRAK3 polyclonal antibody

Sign In for Pricing
View Details
IRAK3 polyclonal antibody
BS7148-02 100 µL

IRAK3 polyclonal antibody

Sign In for Pricing
View Details
Rat Cd8a / T-cell surface glycoprotein CD8 alpha chain Recombinant Protein
R0953r 1 Each

Rat Cd8a / T-cell surface glycoprotein CD8 alpha chain Recombinant Protein

Sign In for Pricing
View Details